General Information

  • ID:  hor005211
  • Uniprot ID:  P63295
  • Protein name:  Glucagon-like peptide
  • Gene name:  NA
  • Organism:  Anguilla rostrata (American eel) (Muraena rostrata)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anguilla (genus), Anguillidae (family), Anguilliformes (order), Elopomorpha, Elopocephala, Elopocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HAEGTYTSDVSSYLQDQAAKEFVSWLKTGR
  • Length:  30
  • Propeptide:  HAEGTYTSDVSSYLQDQAAKEFVSWLKTGR
  • Signal peptide:  NA
  • Modification:  T30 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  plays an important regulatory role
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P63295-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P63295-F1.pdbhor005211_AF2.pdbhor005211_ESM.pdb

Physical Information

Mass: 389310 Formula: C149H224N40O50
Absent amino acids: CIMNP Common amino acids: S
pI: 5.59 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -73 Boman Index: -6387
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.33
Instability Index: 2616.67 Extinction Coefficient cystines: 8480
Absorbance 280nm: 292.41

Literature

  • PubMed ID:  1874385
  • Title:  The primary structure of glucagon-like peptide but not insulin has been conserved between the American eel, Anguilla rostrata and the European eel, Anguilla anguilla.